PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000504.1.g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB_related
Protein Properties Length: 762aa    MW: 85122.1 Da    PI: 8.2885
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000504.1.g00005.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding383.9e-12114154445
                                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                     W ++E+ ll+++++++G g+W+ +++++g +R + qc+++++
  FANhyb_rscf00000504.1.g00005.1 114 WNADEEMLLLEGIEMYGFGNWTEVSEHVG-TRRRQQCIDHYN 154
                                     *****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002911.5E-115095IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013510.5875497IPR000433Zinc finger, ZZ-type
CDDcd023359.19E-2554102No hitNo description
PfamPF005699.9E-85486IPR000433Zinc finger, ZZ-type
SuperFamilySSF578501.41E-1354117No hitNo description
PROSITE patternPS0135705683IPR000433Zinc finger, ZZ-type
SuperFamilySSF466894.04E-12107160IPR009057Homeodomain-like
PROSITE profilePS5129320.877109161IPR017884SANT domain
SMARTSM007171.9E-11110159IPR001005SANT/Myb domain
PfamPF002495.2E-12113154IPR001005SANT/Myb domain
CDDcd001678.05E-12114154No hitNo description
Gene3DG3DSA:1.10.10.606.1E-9114156IPR009057Homeodomain-like
SuperFamilySSF466898.42E-11463524IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MGRSRAVAQS APGDSNQSRG KRKRTASGAE VAENSSAAQK GLAQELSEPK GAFYHCNYCQ  60
KDISGKIRIK CGVCPDFDLC IECFSVGVEV TPHKCNHPYR VMDNLSFPLI CPDWNADEEM  120
LLLEGIEMYG FGNWTEVSEH VGTRRRQQCI DHYNAIYMNS PCFPLPDMSR VMGKSREDLL  180
ALSKGSGEIK KELPMFMEIT LKEESPFSPR VKSEEPKKTA ASKASSHSTA DGVSGAGKKA  240
SNKLQIKDEP KVTKVEESQR SIGGKKLRSL VEEGPSVTEL SGYNYKRQEF EIEYDNDAEQ  300
ILADMEFHDT DTDGDRELKL RVLHVYGKKF STSYSQTLCG NLDRLDERKR RKDFVLERNL  360
LHPDPLEKNL SPEVREIHQR FKVFMRFHSN EDHKELLKSI IEEQQIVKRI LDLQEARAAG  420
CRTATEASNY LEQKRKNETP WGAARGSAIL HPGPKDLSLI TQPISNSLDD WDISGLMGAD  480
LLSETEKRLC CELRILPSHY LHMLQTISTE TLNGNVKKKS DSPQPLQATK DPSLDILPVD  540
RHPIYLAMVK DHRYHIRNVI LQAPQEGTMI RDMCTLSHIV HVQPCFYIAS EIMQKHLTPS  600
VVNVTKSHVA LPPRGGSLMS MRAIGPSSRP QAQGSVGSPV SVTAGHSVGS SFQRANKPSN  660
LVQQSSGLSH QVACPYCYST SLSNVAKFNS IPGPFLLVMD LPLFSFSSNL SAFIKFLLKT  720
SEFKCSFQTL NARFQCKVED RADKLAVGKG TSVLKLEARL SR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1347352RKRRKD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004303562.10.0PREDICTED: transcriptional adapter ADA2 isoform X1
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLM5WRZ20.0M5WRZ2_PRUPE; Uncharacterized protein
STRINGVIT_12s0057g00920.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726